HORDB

General Information

ID: hor000210
Uniprot ID: Q9JI85
Protein name: Nesfatin-1
Gene name: Nucb2
Organism: Rattus norvegicus (Rat)
Family: Nucleobindin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001965 G-protein alpha-subunit binding; GO:0003677 DNA binding; GO:0005085 guanyl-nucleotide exchange factor activity; GO:0005164 tumor necrosis factor receptor binding; GO:0005509 calcium ion binding; GO:0046872 metal ion binding
GO BP: GO:0007264 small GTPase-mediated signal transduction; GO:0009749 response to glucose; GO:0032099 negative regulation of appetite; GO:0042594 response to starvation; GO:0043951 negative regulation of cAMP-mediated signaling; GO:0044752 response to human chorionic gonadotropin; GO:0045599 negative regulation of fat cell differentiation; GO:0046321 positive regulation of fatty acid oxidation; GO:0046627 negative regulation of insulin receptor signaling pathway; GO:0070093 negative regulation of glucagon secretion; GO:1901142 insulin metabolic process; GO:1990680 response to melanocyte-stimulating hormone; GO:2000845 positive regulation of testosterone secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0005635 nuclear envelope; GO:0005640 nuclear outer membrane; GO:0005737 cytoplasm; GO:0005783 endoplasmic reticulum; GO:0005793 endoplasmic reticulum-Golgi intermediate compartment; GO:0005794 Golgi apparatus; GO:0005797 Golgi medial cisterna; GO:0016020 membrane

Sequence Information

Sequence: VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Length: 82
Propeptide: MRWRTIQARYCFLLVPCVLTALEAVPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELKRQEVGRLRMLIKAKLDALQDTGMNHHLLLKQFEHLNHQNPDTFESKDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEEAKFAEMKRKHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTKELDKVYNPQNAEDDMIEMEEERLRMREHVMNEIDNNKDRLVTLEEFLRATEKKEFLEPDSWETLDQQQLFTEEELKEYESIIAIQESELKKKADELQKQKEELQRQHDHLEAQKQEYQQAVQQLEQKKFQQGIAPSGPAGELKFEPHT
Signal peptide: MRWRTIQARYCFLLVPCVLTALEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.
Mechanism: NEFA stands for N=DNA-binding; EF=EF-hand; A=Acidic region.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q9JI85-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000210_AF2.pdb

hor000210_ESM.pdb

Physical Information

Mass:	1102776	Formula:	C424H684N116O136
Absent amino acids:	CMW	Common amino acids:	E
pI:	4.6	Basic residues:	15
Polar residues:	14	Hydrophobic residues:	26
Hydrophobicity:	-71.1	Boman Index:	-21531
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	100.85
Instability Index:	5944.15	Extinction Coefficient cystines:	4470
Absorbance 280nm:	55.19

Literature

PubMed ID: 17036007
Title: Identification of nesfatin-1 as a satiety molecule in the hypothalamus.
PubMed ID: 22293188
Title: A Novel Adipocytokine, nesfatin-1 Modulates Peripheral Arterial Contractility and Blood Pressure in Rats.