General Information

  • ID:  hor000210
  • Uniprot ID:  Q9JI85
  • Protein name:  Nesfatin-1
  • Gene name:  Nucb2
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Nucleobindin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001965 G-protein alpha-subunit binding; GO:0003677 DNA binding; GO:0005085 guanyl-nucleotide exchange factor activity; GO:0005164 tumor necrosis factor receptor binding; GO:0005509 calcium ion binding; GO:0046872 metal ion binding
  • GO BP:  GO:0007264 small GTPase-mediated signal transduction; GO:0009749 response to glucose; GO:0032099 negative regulation of appetite; GO:0042594 response to starvation; GO:0043951 negative regulation of cAMP-mediated signaling; GO:0044752 response to human chorionic gonadotropin; GO:0045599 negative regulation of fat cell differentiation; GO:0046321 positive regulation of fatty acid oxidation; GO:0046627 negative regulation of insulin receptor signaling pathway; GO:0070093 negative regulation of glucagon secretion; GO:1901142 insulin metabolic process; GO:1990680 response to melanocyte-stimulating hormone; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0005635 nuclear envelope; GO:0005640 nuclear outer membrane; GO:0005737 cytoplasm; GO:0005783 endoplasmic reticulum; GO:0005793 endoplasmic reticulum-Golgi intermediate compartment; GO:0005794 Golgi apparatus; GO:0005797 Golgi medial cisterna; GO:0016020 membrane

Sequence Information

  • Sequence:  VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
  • Length:  82(25-106)
  • Propeptide:  MRWRTIQARYCFLLVPCVLTALEAVPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDELKRQEVGRLRMLIKAKLDALQDTGMNHHLLLKQFEHLNHQNPDTFESKDLDMLIKAATADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEEAKFAEMKRKHEDHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDV
  • Signal peptide:  MRWRTIQARYCFLLVPCVLTALEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on p
  • Mechanism:  NEFA stands for N=DNA-binding; EF=EF-hand; A=Acidic region.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9JI85-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000210_AF2.pdbhor000210_ESM.pdb

Physical Information

Mass: 1102776 Formula: C424H684N116O136
Absent amino acids: CMW Common amino acids: E
pI: 4.6 Basic residues: 15
Polar residues: 14 Hydrophobic residues: 26
Hydrophobicity: -71.1 Boman Index: -21531
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 100.85
Instability Index: 5944.15 Extinction Coefficient cystines: 4470
Absorbance 280nm: 55.19

Literature

  • PubMed ID:  17036007
  • Title:  Identification of nesfatin-1 as a satiety molecule in the hypothalamus.
  • PubMed ID:  22293188
  • Title:  A Novel Adipocytokine, nesfatin-1 Modulates Peripheral Arterial Contractility and Blood Pressure in Rats.