General Information

  • ID:  hor000198
  • Uniprot ID:  Q9NGP0
  • Protein name:  Crustacean hyperglycemic hormone B
  • Gene name:  NA
  • Organism:  Metapenaeus ensis (Greasyback shrimp) (Penaeus ensis)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Expressed at a constant level in the eyestalks of juveniles and mature females. A low level expression is seen in the central nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Metapenaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLFDPSCTGVFDRELLGRLNRVCDDCYNVFREPKVATECRSHCFLNPAFIQCLEYIIPEVLHEEYQANVQLV
  • Length:  72(40-111)
  • Propeptide:  MVAFRMMSMALLVVVASSWWASPVEAASSPRVDHRLVRRSLFDPSCTGVFDRELLGRLNRVCDDCYNVFREPKVATECRSHCFLNPAFIQCLEYIIPEVLHEEYQANVQLVGK
  • Signal peptide:  MVAFRMMSMALLVVVASSWWASPVEA
  • Modification:  T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reprodu
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-Q9NGP0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000198_AF2.pdbhor000198_ESM.pdb

Physical Information

Mass: 963517 Formula: C371H569N99O110S6
Absent amino acids: MW Common amino acids: LEV
pI: 4.48 Basic residues: 8
Polar residues: 20 Hydrophobic residues: 26
Hydrophobicity: -4.17 Boman Index: -11867
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.94
Instability Index: 5228.89 Extinction Coefficient cystines: 4845
Absorbance 280nm: 68.24

Literature

  • PubMed ID:  10781818
  • Title:  Molecular Characterization of an Additional Shrimp Hyperglycemic Hormone: cDNA Cloning, Gene Organization, Expression and Biological Assay of Recombinant Proteins