General Information

  • ID:  hor000192
  • Uniprot ID:  Q26181
  • Protein name:  Crustacean hyperglycemic hormones
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLFDPSCTGVFDRQLLRRLRRVCDDCFNVFREPNVSTECRSNCYNNEVFRQCMEYLLPPHLHEEHRLAVQMV
  • Length:  72(7-78)
  • Propeptide:  AGLTKRSLFDPSCTGVFDRQLLRRLRRVCDDCFNVFREPNVSTECRSNCYNNEVFRQCMEYLLPPHLHEEHRLAVQMVGK
  • Signal peptide:  NA
  • Modification:  T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reprodu
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-Q26181-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000192_AF2.pdbhor000192_ESM.pdb

Physical Information

Mass: 990144 Formula: C372H579N113O109S8
Absent amino acids: IKW Common amino acids: RL
pI: 6.74 Basic residues: 12
Polar residues: 20 Hydrophobic residues: 21
Hydrophobicity: -45.42 Boman Index: -19517
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 72.92
Instability Index: 8154.58 Extinction Coefficient cystines: 3355
Absorbance 280nm: 47.25

Literature

  • PubMed ID:  8812330
  • Title:  Characterization of Hyperglycemic and Molt-Inhibiting Activity From Sinus Glands of the Penaeid Shrimp Penaeus Vannamei