General Information

  • ID:  hor000190
  • Uniprot ID:  P56688
  • Protein name:  MOIH precursor-related peptide
  • Gene name:  NA
  • Organism:  Libinia emarginata (Portly spider crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Libinia (genus), Majidae (family), Majoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSTQGYGRMDKLLATLMGSSEGGALESASQHSLE
  • Length:  34(27-60)
  • Propeptide:  MTTKCTVMAVVLAACICLQVLPQAYGRSTQGYGRMDKLLATLMGSSEGGALESASQHSLEKRQIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTVGKK
  • Signal peptide:  MTTKCTVMAVVLAACICLQVLPQAYG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ. Also has hyperglycemic activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P56688-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000190_AF2.pdbhor000190_ESM.pdb

Physical Information

Mass: 415773 Formula: C147H243N45O54S2
Absent amino acids: CFINPVW Common amino acids: S
pI: 5.62 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 8
Hydrophobicity: -54.12 Boman Index: -6653
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 66.18
Instability Index: 3421.47 Extinction Coefficient cystines: 1490
Absorbance 280nm: 45.15

Literature

  • PubMed ID:  9783445
  • Title:  cDNA Cloning of a Mandibular Organ Inhibiting Hormone From the Spider Crab Libinia Emarginata