General Information

  • ID:  hor000188
  • Uniprot ID:  Q25154
  • Protein name:  Crustacean hyperglycemic hormone B
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMV
  • Length:  72(61-132)
  • Propeptide:  MFACRTLCLVVVMVASLGTSGVGGRSVEGVSRMEKLLSSSISPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMVGK
  • Signal peptide:  MFACRTLCLVVVMVASLGTSGVGG
  • Modification:  T1 Pyrrolidone carboxylic acid;T3 D-phenylalanine;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reprodu
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P08934-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P08934-F1.pdbhor000188_AF2.pdbhor000188_ESM.pdb

Physical Information

Mass: 987850 Formula: C377H590N104O113S7
Absent amino acids: HW Common amino acids: V
pI: 6.32 Basic residues: 10
Polar residues: 23 Hydrophobic residues: 23
Hydrophobicity: -30 Boman Index: -16589
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 86.39
Instability Index: 1859.17 Extinction Coefficient cystines: 7825
Absorbance 280nm: 110.21

Literature

  • PubMed ID:  1879416
  • Title:  Cloning and Sequence Analysis of cDNA Encoding Two Crustacean Hyperglycemic Hormones From the Lobster Homarus Americanus