General Information

  • ID:  hor000186
  • Uniprot ID:  P19806
  • Protein name:  Crustacean hyperglycemic hormone A
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMV
  • Length:  72(61-132)
  • Propeptide:  MMACRTLCLVVVMVASLGTSGVGGRSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMVGK
  • Signal peptide:  MMACRTLCLVVVMVASLGTSGVGG
  • Modification:  T1 Pyrrolidone carboxylic acid;T3 D-phenylalanine;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  MIH may inhibit Y-organs where molting hormone (ecdysteroid) is secreted and a molting cycle is initiated when MIH secretion diminishes or stops.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P01042-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P01042-F1.pdbhor000186_AF2.pdbhor000186_ESM.pdb

Physical Information

Mass: 986744 Formula: C379H581N101O114S7
Absent amino acids: H Common amino acids: VD
pI: 4.64 Basic residues: 9
Polar residues: 22 Hydrophobic residues: 24
Hydrophobicity: -28.75 Boman Index: -15383
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 82.36
Instability Index: 1728.33 Extinction Coefficient cystines: 13325
Absorbance 280nm: 187.68

Literature

  • PubMed ID:  2169734
  • Title:  Amino Acid Sequence of a Peptide With Both Molt-Inhibiting and Hyperglycemic Activities in the Lobster, Homarus Americanus