General Information

  • ID:  hor000169
  • Uniprot ID:  P19806
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PLGFLSQDHSVN
  • Length:  12(47-58)
  • Propeptide:  MMACRTLCLVVVMVASLGTSGVGGRSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMVGK
  • Signal peptide:  MMACRTLCLVVVMVASLGTSGVGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CHH is the most abundant hormone in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone.; MIH may inhibit Y-organs where molti
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19806-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000169_AF2.pdbhor000169_ESM.pdb

Physical Information

Mass: 150982 Formula: C58H88N16O19
Absent amino acids: ACEIKMRTWY Common amino acids: LS
pI: 5.29 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -22.5 Boman Index: -1456
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 89.17
Instability Index: 4126.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus