General Information

  • ID:  hor000143
  • Uniprot ID:  Q9GT02
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Carcinus maenas (Common shore crab) (Green crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcinus (genus), Carcinidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSTPGYGRMDRILAA
  • Length:  15
  • Propeptide:  MYSKTIPAMLAIITVAYLCPLPHAHARSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLEKKQIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRNNCFENEVFDVCVYELYFP
  • Signal peptide:  MYSKTIPAMLAIITVAYLCPLPHAHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GT02-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000143_AF2.pdbhor000143_ESM.pdb

Physical Information

Mass: 191381 Formula: C70H118N24O21S
Absent amino acids: CEFHKNQVW Common amino acids: R
pI: 11.05 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -56 Boman Index: -4190
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 65.33
Instability Index: 3512 Extinction Coefficient cystines: 1490
Absorbance 280nm: 106.43

Literature

  • PubMed ID:  19523386
  • Title:  Characterization of the Carcinus Maenas Neuropeptidome by Mass Spectrometry and Functional Genomics