General Information

  • ID:  hor000115
  • Uniprot ID:  O97374
  • Protein name:  Small cardioactive peptide A
  • Gene name:  SCP
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  SCP family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SGYLAFPRM
  • Length:  9
  • Propeptide:  MEITLPRVSLSLAVLLVIVCSVDAQNYLAFPRMGRSGYLAFPRMGRSHFKSETSADVTGCCGVGIKNEFLIGQDGKEEIRSACGARADCCEGLKEVVDQKNDGVYFSMCVPDITFAQASSVRSSEVFNKLKSLLEK
  • Signal peptide:  MEITLPRVSLSLAVLLVIVCSVDA
  • Modification:  T9 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enhance the contractions of the auricle in vitro.may play an important part in the co-modulation of gut motility, together with acetylcholine and the myomodulin family of peptides
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97374-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000115_AF2.pdbhor000115_ESM.pdb

Physical Information

Mass: 118410 Formula: C48H72N12O12S
Absent amino acids: CDEHIKNQTVW Common amino acids: AFGLMPRSY
pI: 9.35 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: 18.89 Boman Index: -546
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 1247.78 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  10051766
  • Title:  Small Cardioactive Peptide Gene: Structure, Expression and Mass Spectrometric Analysis Reveals a Complex Pattern of Co-Transmitters in a Snail Feeding Neuron.
  • PubMed ID:  9485334
  • Title:  Direct Mass Spectrometric Peptide Profiling and Sequencing of Single Neurons Reveals Differential Peptide Patterns in a Small Neuronal Network