General Information

  • ID:  hor000114
  • Uniprot ID:  P09892
  • Protein name:  Small cardioactive peptide A
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  SCP family
  • Source:  Animal
  • Expression:  Highly expressed in the buccal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ARPGYLAFPRM
  • Length:  11(36-46)
  • Propeptide:  METSVSRVTVSLTLLVLIICSADAMNYLAFPRMGRARPGYLAFPRMGRSQMKTETGTDCCGLGMKSEFVIGQEGKEELRHGACSSSVACCAGLREIVDQKQDGVFFSMCVPDFVASRSSEESSSEVLSKLKSLLQK
  • Signal peptide:  METSVSRVTVSLTLLVLIICSADA
  • Modification:  T11 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the stimulation of contractile activity in the gut, the increase of the amplitude of the heart beat, and enhancement of the contractile response of the radula closer muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09892-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000114_AF2.pdbhor000114_ESM.pdb

Physical Information

Mass: 145708 Formula: C59H91N17O13S
Absent amino acids: CDEHIKNQSTVW Common amino acids: APR
pI: 11.15 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -16.36 Boman Index: -1517
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.64
Instability Index: 2953.64 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  3858852
  • Title:  The Small Cardioactive Peptides A and B of Aplysia Are Derived From a Common Precursor Molecule