General Information

  • ID:  hor000113
  • Uniprot ID:  P09892
  • Protein name:  Small cardioactive peptide B
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  SCP family
  • Source:  Animal
  • Expression:  Highly expressed in the buccal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MNYLAFPRM
  • Length:  9(25-33)
  • Propeptide:  METSVSRVTVSLTLLVLIICSADAMNYLAFPRMGRARPGYLAFPRMGRSQMKTETGTDCCGLGMKSEFVIGQEGKEELRHGACSSSVACCAGLREIVDQKQDGVFFSMCVPDFVASRSSEESSSEVLSKLKSLLQK
  • Signal peptide:  METSVSRVTVSLTLLVLIICSADA
  • Modification:  T9 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulate contractile activity in the gut; increasing the amplitude of the heart beat, and enhancing the contractile response of the radula closer muscle
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09892-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000113_AF2.pdbhor000113_ESM.pdb

Physical Information

Mass: 128527 Formula: C52H79N13O12S2
Absent amino acids: CDEGHIKQSTVW Common amino acids: M
pI: 9.35 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 14.44 Boman Index: -729
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 2191.11 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  3858852
  • Title:  The Small Cardioactive Peptides A and B of Aplysia Are Derived From a Common Precursor Molecule