General Information

  • ID:  hor000109
  • Uniprot ID:  P01179
  • Protein name:  Oxytocin
  • Gene name:  Oxt
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Vasopressin/oxytocin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0001975 response to amphetamine; GO:0002027 regulation of heart rate; GO:0002125 maternal aggressive behavior; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007507 heart development; GO:0007565 female pregnancy; GO:0007567 parturition; GO:0007595 lactation; GO:0007613 memory; GO:0007625 grooming behavior
  • GO CC:  NA

Sequence Information

  • Sequence:  CYIQNCPLG
  • Length:  9(20-28)
  • Propeptide:  MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
  • Signal peptide:  MACPSLACCLLGLLALTSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes contraction of the smooth muscle of the uterus and of the mammary gland;antiulcer activity;contributes to leptin's attenuation of food intake;oxytocin facilitates female sexual development;Regulates nerve activity
  • Mechanism:  release of oxytocin from a descending pPVN-to-NTS pathway contributes to leptin's attenuation of food intake by a mechanism that involves the activation of pPVN oxytocin neurons by leptin, resulting in increased sensitivity of NTS neurons to satiety signals;oxytocin facilitates female sexual development and that this effect is mediated by a mechanism involving glial production of PGE(2).
  • Cross BBB:  NO
  • Target:  Oxtr
  • Target Unid:   P70536
  • IC50:  Prostaglandin F metabolite(PGFM) release on administeration of 10 iu of oxytocin= 18.48???.62 pg/ml ( PubMed ID: 10454085 )
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  6.78 minutes; /406.8 seconds ( PubMed ID: 10454085 )

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-P01179-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000109_AF2.pdbhor000109_ESM.pdb

Physical Information

Mass: 115308 Formula: C43H67N11O13S2
Absent amino acids: ADEFHKMRSTVW Common amino acids: C
pI: 5.81 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: 33.33 Boman Index: 102
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 86.67
Instability Index: 2708.89 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  11764003
  • Title:  Gastric Antisecretory and Antiulcer Activity of Oxytocin in Rats and Guinea Pigs.
  • PubMed ID:  15044184
  • Title:  Evidence that paraventricular nucleus oxytocin neurons link hypothalamic leptin action to caudal brain stem nuclei controlling meal size.
  • PubMed ID:  18039781
  • Title:  Oxytocin Facilitates Female Sexua
  • PubMed ID:  10454085
  • Title: