General Information

  • ID:  hor000108
  • Uniprot ID:  P01179
  • Protein name:  Neurophysin 1
  • Gene name:  Oxt
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Vasopressin/oxytocin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0001975 response to amphetamine; GO:0002027 regulation of heart rate; GO:0002125 maternal aggressive behavior; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007507 heart development; GO:0007565 female pregnancy; GO:0007567 parturition; GO:0007595 lactation; GO:0007613 memory; GO:0007625 grooming behavior
  • GO CC:  NA

Sequence Information

  • Sequence:  AALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
  • Length:  94(32-125)
  • Propeptide:  MACPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCATAGICCSPDGCRTDPACDPESAFSER
  • Signal peptide:  MACPSLACCLLGLLALTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bind oxytocin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Oxtr
  • Target Unid:  P70536
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  AF-P01179-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000108_AF2.pdbhor000108_ESM.pdb

Physical Information

Mass: 1131499 Formula: C394H627N119O134S15
Absent amino acids: HW Common amino acids: CG
pI: 4.5 Basic residues: 9
Polar residues: 39 Hydrophobic residues: 21
Hydrophobicity: -27.45 Boman Index: -15314
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 45.85
Instability Index: 4723.62 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.43

Literature

  • PubMed ID:  7036996
  • Title:  Identification of Rat Neurophysins: Complete Amino Acid Sequences of MSEL- And VLDV-neurophysins