General Information

  • ID:  hor000101
  • Uniprot ID:  P01178
  • Protein name:  Oxytocin
  • Gene name:  OXT
  • Organism:  Homo sapiens (Human)
  • Family:  Vasopressin/oxytocin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with OXT include Endometritis and Chorioamnionitis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  CYIQNCPLG
  • Length:  9
  • Propeptide:  MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
  • Signal peptide:  MAGPSLACCLLGLLALTSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  9-9G->V: Gain of antagonist activity on V1aR/AVPR1A (and loss of agonist activity on this receptor). 310-fold decrease in affinity for oxytocin receptor (OXTR), 13-fold decrease in affinity for V1aR/AVPR1A, and complete loss of affinity for V1bR/AVPR1B an

Activity

  • Function:  Causes contraction of the smooth muscle of the uterus and of the mammary gland;decreases IL-6 production and may affect bone metabolism in humans; has a role in the physiological processes of LH regulation;complex neuromodulatory
  • Mechanism:  Acts by binding to oxytocin receptor
  • Cross BBB:  NO
  • Target:  OXTR
  • Target Unid:  P30559
  • IC50: Prostaglandin F metabolite(PGFM) release on administeration of 10 iu of oxytocin= 18.48±3.62 pg/ml ( PubMed ID: 10454085 )
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 6.78 minutes; /406.8 seconds ( PubMed ID: 10454085 )

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-P01178-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000101_AF2.pdbhor000101_ESM.pdb

Physical Information

Mass: 115308 Formula: C43H67N11O13S2
Absent amino acids: ADEFHKMRSTVW Common amino acids: C
pI: 5.81 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: 33.33 Boman Index: 102
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 2708.89 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  12126740
  • Title:  Oxytocin Stimulates Proliferation of Human Osteoblast-Like Cells
  • PubMed ID:  12832367
  • Title:  Evidence That Oxytocin Is a Physiological Component of LH Regulation in Non-Pregnant Women.
  • PubMed ID:  10454085
  • Title: