General Information

  • ID:  hor000100
  • Uniprot ID:  P01178
  • Protein name:  Neurophysin 1
  • Gene name:  OXT
  • Organism:  Homo sapiens (Human)
  • Family:  Vasopressin/oxytocin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with OXT include Endometritis and Chorioamnionitis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0005515 protein binding; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
  • Length:  94
  • Propeptide:  MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
  • Signal peptide:  MAGPSLACCLLGLLALTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bind oxytocin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  OXTR
  • Target Unid:  P30559
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  1jk4(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1jk4.pdbhor000100_AF2.pdbhor000100_ESM.pdb

Physical Information

Mass: 1125997 Formula: C395H626N120O131S14
Absent amino acids: MW Common amino acids: CG
pI: 4.69 Basic residues: 9
Polar residues: 37 Hydrophobic residues: 25
Hydrophobicity: -15.64 Boman Index: -12762
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.15
Instability Index: 6344.36 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.43

Literature

  • PubMed ID:  6574452
  • Title:  Identification of Human Neurophysins: Complete Amino Acid Sequences of MSEL- And VLDV-neurophysins