General Information

  • ID:  hor000079
  • Uniprot ID:  Q00945
  • Protein name:  Lys-conopressin G
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Vasopressin/oxytocin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CFIRNCPKG
  • Length:  9(27-35)
  • Propeptide:  MMSSLCGMPLTYLLTAAVLSLSLTDACFIRNCPKGGKRSLDTGMVTSRECMKCGPGGTGQCVGPSICCGQDFGCHVGTAEAAVCQQENDSSTPCLVKGEACGSRDAGNCVADGICCDSESCAVNDRCRDLDGNAQANRGDLIQLIHKLLKVRDYD
  • Signal peptide:  MMSSLCGMPLTYLLTAAVLSLSLTDA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the control of sexual behavior
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-Q00945-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000079_AF2.pdbhor000079_ESM.pdb

Physical Information

Mass: 118014 Formula: C44H72N14O11S2
Absent amino acids: ADEHLMQSTVWY Common amino acids: C
pI: 8.83 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -17.78 Boman Index: -1571
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 3136.67 Extinction Coefficient cystines: 125
Absorbance 280nm: 15.63

Literature

  • PubMed ID:  1584795
  • Title:  Evolution of the Vasopressin/Oxytocin Superfamily: Characterization of a cDNA Encoding a Vasopressin-Related Precursor, Preproconopressin, From the Mollusc Lymnaea Stagnalis