General Information

  • ID:  hor000076
  • Uniprot ID:  Q7M428
  • Protein name:  Vasotocin
  • Gene name:  NA
  • Organism:  Eptatretus stoutii (Pacific hagfish)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eptatretus (genus), Eptatretinae (subfamily), Myxinidae (family), Myxiniformes (order), Myxini (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CYIQNCPRG
  • Length:  9
  • Propeptide:  MSAMGWTLLAAALLAISAQSNGCYIQNCPRGGKRAVETELHSCAACGLGGQCVGPSICCGGLLGGGRGGGCIVGGPLSAPCKRENLHPEPCRPGGGSSCGLEGICAAPGICCTDVTCSIDATCDDVTEKAGVTFSGATGGLANPTGDLLRKVLLLANADLE
  • Signal peptide:  MSAMGWTLLAAALLAISAQSNG
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Antidiuretic hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-Q7M428-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000076_AF2.pdbhor000076_ESM.pdb

Physical Information

Mass: 119610 Formula: C43H68N14O13S2
Absent amino acids: ADEFHKLMSTVW Common amino acids: C
pI: 8.22 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -58.89 Boman Index: -1882
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 927.78 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  1379721
  • Title:  Presence of a Member of the Tc1-like Transposon Family From Nematodes and Drosophila Within the Vasotocin Gene of a Primitive Vertebrate, the Pacific Hagfish Eptatretus Stouti