General Information

  • ID:  hor000075
  • Uniprot ID:  P10769
  • Protein name:  Copeptin
  • Gene name:  AVP
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGDRSNVTQLDGPAGALLLRLMQLAGAPEPQPAAPGGY
  • Length:  38
  • Propeptide:  CYFQNCPRGGKRALSDTELRQCLPCGPGGQGRCFGPSICCADALGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAANGVCCNDESCVIEPECREEFHRPVRAGDRSNVTQLDGPAGALLLRLMQLAGAPEPQPAAPGGY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T6 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:  H0VM08, A0A286XZX0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10769-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000075_AF2.pdbhor000075_ESM.pdb

Physical Information

Mass: 443445 Formula: C164H266N48O52S
Absent amino acids: CFHIKW Common amino acids: A
pI: 4.37 Basic residues: 2
Polar residues: 10 Hydrophobic residues: 14
Hydrophobicity: -13.68 Boman Index: -2924
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 87.63
Instability Index: 5477.89 Extinction Coefficient cystines: 1490
Absorbance 280nm: 40.27

Literature

  • PubMed ID:  3081370
  • Title:  Guinea Pig Copeptin. The Glycopeptide Domain of the Vasopressin Precursor