General Information

  • ID:  hor000070
  • Uniprot ID:  P08163
  • Protein name:  Neurophysin VT
  • Gene name:  NA
  • Organism:  Bufo japonicus (Japanese toad)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bufo (genus), Bufonidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYPDTAVRQCIPCGPGNRGNCFGPNICCGEDLGCYVGTPETLRCVEETYLPSPCEAGGKPCSSGGRCAAPGVCCSDDTCVVDSSCLDEDSERR
  • Length:  93
  • Propeptide:  TAPVPACFLCLLALSSACYIQNCPRGGKRSYPDTAVRQCIPCGPGNRGNCFGPNICCGEDLGCYVGTPETLRCVEETYLPSPCEAGGKPCSSGGRCAAPGVCCSDDTCVVDSSCLDEDSERRRVTPEQNMTQMDGSASDLLLRLMHMANRQQQSKHQFY
  • Signal peptide:  TAPVPACFLCLLALSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Vasotocin is an antidiuretic hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  AF-P08163-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000070_AF2.pdbhor000070_ESM.pdb

Physical Information

Mass: 1130391 Formula: C391H616N116O142S14
Absent amino acids: HMW Common amino acids: C
pI: 4.03 Basic residues: 7
Polar residues: 45 Hydrophobic residues: 17
Hydrophobicity: -34.95 Boman Index: -17653
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.17
Instability Index: 4704.19 Extinction Coefficient cystines: 5345
Absorbance 280nm: 58.1

Literature

  • PubMed ID:  3033676
  • Title:  Cloning and Sequence Analysis of cDNAs for Neurohypophysial Hormones Vasotocin and Mesotocin for the Hypothalamus of Toad, Bufo Japonicus