General Information

  • ID:  hor000069
  • Uniprot ID:  P08163
  • Protein name:  Hydrin-2
  • Gene name:  NA
  • Organism:  Bufo japonicus (Japanese toad)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bufo (genus), Bufonidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CYIQNCPRGG
  • Length:  10
  • Propeptide:  TAPVPACFLCLLALSSACYIQNCPRGGKRSYPDTAVRQCIPCGPGNRGNCFGPNICCGEDLGCYVGTPETLRCVEETYLPSPCEAGGKPCSSGGRCAAPGVCCSDDTCVVDSSCLDEDSERRRVTPEQNMTQMDGSASDLLLRLMHMANRQQQSKHQFY
  • Signal peptide:  TAPVPACFLCLLALSSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Vasotocin is an antidiuretic hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-P08163-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000069_AF2.pdbhor000069_ESM.pdb

Physical Information

Mass: 127099 Formula: C45H71N15O14S2
Absent amino acids: ADEFHKLMSTVW Common amino acids: CG
pI: 8.22 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 1
Hydrophobicity: -57 Boman Index: -1788
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 2169 Extinction Coefficient cystines: 1615
Absorbance 280nm: 179.44

Literature

  • PubMed ID:  3033676
  • Title:  Cloning and Sequence Analysis of cDNAs for Neurohypophysial Hormones Vasotocin and Mesotocin for the Hypothalamus of Toad, Bufo Japonicus