General Information

  • ID:  hor000067
  • Uniprot ID:  P08162
  • Protein name:  Mesotocin
  • Gene name:  NA
  • Organism:  Bufo japonicus (Japanese toad)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  Mesotocin is produced by magnocellular preoptic neurons in the hypothalamus in amphibians, reptiles and birds.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bufo (genus), Bufonidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CYIQNCPIG
  • Length:  9
  • Propeptide:  MSYTALAVTFFGWLALSSACYIQNCPIGGKRSVIDFMDVRKCIPCGPRNKGHCFGPNICCGEELGCYFGTTETLRCQEENFLPSPCESGRKPCGNNGGNCARSGICCNHESCTMDPACEQDSVFS
  • Signal peptide:  MSYTALAVTFFGWLALSSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Diuretic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-P08162-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000067_AF2.pdbhor000067_ESM.pdb

Physical Information

Mass: 115308 Formula: C43H67N11O13S2
Absent amino acids: ADEFHKLMRSTVW Common amino acids: CI
pI: 5.81 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: 41.11 Boman Index: 102
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 2708.89 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  3033676
  • Title:  Cloning and Sequence Analysis of cDNAs for Neurohypophysial Hormones Vasotocin and Mesotocin for the Hypothalamus of Toad, Bufo Japonicus