General Information

  • ID:  hor000065
  • Uniprot ID:  P01184
  • Protein name:  Vasopressin-neurophysin 2
  • Gene name:  AVP
  • Organism:  Balaenoptera physalus (Fin whale) (Balaena physalus)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Balaenoptera (genus), Balaenopteridae (family), Mysticeti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFMGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGASFPRRA
  • Length:  95
  • Propeptide:  CYFQNCPRGXXXAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFMGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGASFPRRA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels.
  • Mechanism:  Acts by binding to vasopressin receptors
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000065_AF2.pdbhor000065_ESM.pdb

Physical Information

Mass: 1156408 Formula: C401H640N124O136S16
Absent amino acids: HW Common amino acids: CG
pI: 4.55 Basic residues: 9
Polar residues: 40 Hydrophobic residues: 20
Hydrophobicity: -33.05 Boman Index: -16491
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 44.32
Instability Index: 5956.63 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.16

Literature

  • PubMed ID:  639997
  • Title:  Phylogeny of Neurophysins: Complete Amino Acid Sequence of Whale (Balaenoptera Physalus) MSEL-neurophysin