General Information

  • ID:  hor000057
  • Uniprot ID:  Q9QZQ3
  • Protein name:  Urotensin II
  • Gene name:  UTS2
  • Organism:  Mus musculus (Mouse)
  • Family:  Urotensin-2 family
  • Source:  animal
  • Expression:  Brain specific. Predominantly expressed in motoneurons of the brainstem and spinal cord.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0001666 response to hypoxia; GO:0003105 negative regulation of glomerular filtration; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008217 regulation of blood pressure; GO:0009410 response to xenobiotic stimulus; GO:0010459 negative regulation of heart rate; GO:0010460 positive regulation of heart rate; GO:0010763 positive regulation of fibroblast migration; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0032224 positive regulation of synaptic transmission, cholinergic; GO:0032967 positive regulation of collagen biosynthetic process; GO:0033574 response to testosterone
  • GO CC:  NA

Sequence Information

  • Sequence:  QHGAAPECFWKYCI
  • Length:  14
  • Propeptide:  MDRVPFCCLLFIGLLNPLLSLPVTDTGERTLQLPVLEEDALRALEELERMALLQTLRQTMGTEAGESPGEAGPSTETPTPRGSMRKAFAGQNSNTVLSRLLARTRKQHKQHGAAPECFWKYCI
  • Signal peptide:  MDRVPFCCLLFIGLLNPLLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in some aspects of anxiety, depressive, and ingestive disorders;induces mice skeletal muscle atrophy associated with enhanced skeletal muscle autophagy and inhibited FNDC5 expression in chronic renal failure;highly potent vasoconstrictor;induces mice skeletal muscle atrophy associated with enhanced skeletal muscle autophagy and inhibited FNDC5 expression in chronic renal failure; modulates cholesterol regulation
  • Mechanism:  U-II-induced vasoconstriction is attenuated by inhibition of phospholipase C-mediated [Ca2+]i-mobilization from the sarcoplasmic reticulum (leading to a secondary membrane depolarization and [Ca2+]i-influx) and by L-type [Ca2+]-channel blockers, calmodulin antagonism and by chelation of extracellular [Ca2+]e.
  • Cross BBB:  NA
  • Target:  Uts2r, Uts2b
  • Target Unid:  Q8VIH9, Q765I1
  • IC50: NA
  • EC50: intracellular [Ca2+] concentrations:3.2+/-0.8nm;inositol phosphate (Ip) formation:7.2+/-1.8nm
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-13
  • Structure ID:  AF-Q9QZQ3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000057_AF2.pdbhor000057_ESM.pdb

Physical Information

Mass: 188498 Formula: C76H105N19O19S2
Absent amino acids: DLMNRSTV Common amino acids: AC
pI: 7.25 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 5
Hydrophobicity: -17.14 Boman Index: -535
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 42.14
Instability Index: 5337.14 Extinction Coefficient cystines: 7115
Absorbance 280nm: 547.31

Literature

  • PubMed ID:  16160878
  • Title:  Behavioral Effects of urotensin-II Centrally Administered in Mice.
  • PubMed ID:  11976263
  • Title:  Molecular and pharmacological characterization of genes encoding urotensin-II peptides and their cognate G-protein-coupled receptors from the mouse and monkey
  • PubMed ID:  31238319
  • Title:  Urotensin II Induces Mice Skeletal Muscle Atrophy Associated With Enhanced Autophagy and Inhibited Irisin Precursor (Fibronectin Type III Domain Containing 5) Expression in Chronic Renal Failure