General Information

  • ID:  hor000056
  • Uniprot ID:  O95399
  • Protein name:  Urotensin II
  • Gene name:  UTS2
  • Organism:  Homo sapiens (Human)
  • Family:  Urotensin-2 family
  • Source:  Human
  • Expression:  Brain specific.
  • Disease:  Diseases associated with UTS2 include Portal Hypertension and Congestive Heart Failure.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0006936 muscle contraction; GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0045202 synapse

Sequence Information

  • Sequence:  ETPDCFWKYCV
  • Length:  11
  • Propeptide:  MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
  • Signal peptide:  MYKLASCCLLFIGFLNPLLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Highly potent vasoconstrictor;exhibits motor suppressive and delayed anxiolytic-like effects suggesting a time-dependent role in the regulation of stress-related behavior;exert a specific angiogenic activity
  • Mechanism:  hU-II may play a novel role in pulmonary hypertension via activation of ROS generation by NADPH oxidase in PASMCs, leading to redox-sensitive activation of mitogen-activated protein kinases and Akt and subsequently to enhanced PAI-1 expression and increased proliferation.
  • Cross BBB:  NA
  • Target:  UTS2R, UTS2B
  • Target Unid:  Q9UKP6, Q765I0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  5-10
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000056_AF2.pdbhor000056_ESM.pdb

Physical Information

Mass: 156914 Formula: C64H87N13O18S2
Absent amino acids: AGHILMNQRS Common amino acids: C
pI: 4.18 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -30.91 Boman Index: -1188
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 26.36
Instability Index: -461.82 Extinction Coefficient cystines: 7115
Absorbance 280nm: 711.5

Literature

  • PubMed ID:  10499587
  • Title:  Human urotensin-II Is a Potent Vasoconstrictor and Agonist for the Orphan Receptor GPR14
  • PubMed ID:  12088848
  • Title:  Human Urocortin II: Mild Locomotor Suppressive and Delayed Anxiolytic-Like Effects of a Novel Corticotropin-Releasing Factor Related Peptide.