General Information

  • ID:  hor000055
  • Uniprot ID:  Q8HYC2
  • Protein name:  Urotensin II
  • Gene name:  UTS2
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  Urotensin-2 family
  • Source:  animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPPSECFWKYCV
  • Length:  12
  • Propeptide:  MSKLVPCLLLLGCLGLLFALPVPDSRKEPLPFSAPEDVRSAWDELERASLLQMLPETPGAEAGEDLREADAGMDIFYPRGEMRKAFSGQDPNIFLSHLLARIKKPYKKRGPPSECFWKYCV
  • Signal peptide:  MSKLVPCLLLLGCLGLLFAL
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Highly potent vasoconstrictor.
  • Mechanism:  U-II-induced vasoconstriction is attenuated by inhibition of phospholipase C-mediated [Ca2+]i-mobilization from the sarcoplasmic reticulum (leading to a secondary membrane depolarization and [Ca2+]i-influx) and by L-type [Ca2+]-channel blockers, calmodulin antagonism and by chelation of extracellular [Ca2+]e.
  • Cross BBB:  NA
  • Target:  UTS2R, UTS2B
  • Target Unid:  Q8HYC3, A0A5F8A3Z3
  • IC50: NA
  • EC50: intracellular [Ca2+] concentrations:1.1+/-0.3nm;inositol phosphate (Ip) formation:0.9+/-0.2nm
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8HYC2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000055_AF2.pdbhor000055_ESM.pdb

Physical Information

Mass: 161202 Formula: C66H90N14O17S2
Absent amino acids: ADHILMNQRT Common amino acids: CP
pI: 6.13 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -16.67 Boman Index: -305
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 24.17
Instability Index: 8765 Extinction Coefficient cystines: 7115
Absorbance 280nm: 646.82

Literature

  • PubMed ID:  11976263
  • Title:  Molecular and pharmacological characterization of genes encoding urotensin-II peptides and their cognate G-protein-coupled receptors from the mouse and monkey