General Information

  • ID:  hor000052
  • Uniprot ID:  P20156
  • Protein name:  VGF(24-63)
  • Gene name:  Vgf
  • Organism:  Rattus norvegicus (Rat)
  • Family:  VGF family
  • Source:  animal
  • Expression:  By nerve growth factor.|Central and peripheral nervous systems, synthesized exclusively in neuronal and neuroendocrine cells. VGF and several of the derived peptides are present in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0001541 ovarian follicle development; GO:0002021 response to dietary excess; GO:0006091 generation of precursor metabolites and energy; GO:0007165 signal transduction; GO:0009409 response to cold; GO:0019953 sexual reproduction; GO:0030073 insulin secretion; GO:0030182 neuron differentiation; GO:0032868 response to insulin; GO:0042593 glucose homeostasis
  • GO CC:  NA

Sequence Information

  • Sequence:  APPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAA
  • Length:  40
  • Propeptide:  MKTFTLPASVLFCFLLLIRGLGAAPPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAARNSEPQDQGELFQGVDPRALAAVLLQALDRPASPPAVPAGSQQGTPEEAAEALLTESVRSQTHSLPASEIQASAVAPPRPQTQDNDPEADDRSEELEALASLLQELRDFSPSNAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPSVPSQFQARMSENVPLPETHQFGEGVSSPKTHLGETLTPLSKAYQSLSAPFPKVRRLEGSFLGGSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRDLGGRGLQETQQERENEREEEAEQERRGGGEDEVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRSQEEAPGHRRKDAEGTEEGGEEDDDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAPARDELPDWNEVLPPWDREEDEVFPPGPYHPFPNYIRPRTLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP
  • Signal peptide:  MKTFTLPASVLFCFLLLIRGLGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enhanced synaptic activity;Effects on spontaneous excitability of superficial dorsal horn neurons;Antidepressant effects;Spinal plasticity;Long-term memory formation
  • Mechanism:  induces a fast increase in intracellular calcium mobilization via its release from intracellular storage and membrane calcium channel opening
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P20156-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000052_AF2.pdbhor000052_ESM.pdb

Physical Information

Mass: 486431 Formula: C178H280N54O62
Absent amino acids: CFIMTW Common amino acids: P
pI: 4.43 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -88 Boman Index: -9921
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 58.5
Instability Index: 7282.25 Extinction Coefficient cystines: 1490
Absorbance 280nm: 38.21

Literature

  • PubMed ID:  19164277
  • Title:  Discovering New Bioactive Neuropeptides in the Striatum Secretome Using in Vivo Microdialysis and Versatile Proteomics