General Information

  • ID:  hor000040
  • Uniprot ID:  Q19569
  • Protein name:  Neuropeptide-like protein 7
  • Gene name:  nlp-7
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  animal
  • Expression:  Up-regulated when diet is restricted.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008340 determination of adult lifespan; GO:0061771 response to caloric restriction; GO:1901046 positive regulation of egg-laying behavior; GO:1901562 response to paraquat
  • GO CC:  NA

Sequence Information

  • Sequence:  LYLKQADFDDPRMFTSSFGKRSAIESEPQAYPKSYRAIRIQRRSMDDLDDPRLMTMSFGKRMILPSLADLHRYTMYDKRGSDIDDPRYFLFSNRLTCRC
  • Length:  99
  • Propeptide:  MYIKAALLIVVLFGVASQITSALYLKQADFDDPRMFTSSFGKRSAIESEPQAYPKSYRAIRIQRRSMDDLDDPRLMTMSFGKRMILPSLADLHRYTMYDKRGSDIDDPRYFLFSNRLTCRC
  • Signal peptide:  MYIKAALLIVVLFGVASQITSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Life-span extension by dietary restriction;regulate spawning time;inhibit vesicular release of serotonin from HSN motor neurons
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q19569-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000040_AF2.pdbhor000040_ESM.pdb

Physical Information

Mass: 1353665 Formula: C516H809N149O152S8
Absent amino acids: VW Common amino acids: RD
pI: 9.45 Basic residues: 19
Polar residues: 26 Hydrophobic residues: 25
Hydrophobicity: -75.45 Boman Index: -29772
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 60.2
Instability Index: 5512.02 Extinction Coefficient cystines: 9065
Absorbance 280nm: 92.5

Literature

  • PubMed ID:  19783783
  • Title:  Life-span extension by dietary restriction is mediated by NLP-7 signaling and coelomocyte endocytosis in?C. elegans.
  • PubMed ID:  28384151
  • Title:  Local neuropeptide signaling modulates serotonergic transmission to shape the temporal organization of C. elegans egg-laying behavior